Loading...
Statistics
Advertisement

cherrybeard.com is almost here!
www.cherrybeard.com/
The owner of this domain has not yet uploaded their website.

Cherrybeard.com

Advertisement
Conversion Technology Metas Server
Cherrybeard.com is hosted in United States / Brea . Cherrybeard.com uses HTTPS protocol. Number of used technologies: 2. First technologies: CSS, Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Cherrybeard.com

Technology

Number of occurences: 2
  • CSS
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Cherrybeard.com

SSL certificate

    • name: /C=US/ST=California/O=DreamHost/CN=sni.dreamhost.com
    • subject:
      • C: US
      • ST: California
      • O: DreamHost
      • CN: sni.dreamhost.com
    • hash: cce3888a
    • issuer:
      • C: US
      • ST: California
      • O: DreamHost
      • CN: sni.dreamhost.com
    • version: 2
    • serialNumber: 50159747054
    • validFrom: 150811182423Z
    • validTo: 250808182423Z
    • validFrom_time_t: 1439317463
    • validTo_time_t: 1754677463
    • extensions:
      • basicConstraints: CA:FALSE

Meta - Cherrybeard.com

Number of occurences: 1
  • Name: description
    Content: The owner of this domain has not yet uploaded their website.

Server / Hosting

  • IP: 67.205.11.203
  • Latitude: 33.93
  • Longitude: -117.86
  • Country: United States
  • City: Brea

Rname

  • ns3.dreamhost.com
  • ns1.dreamhost.com
  • ns2.dreamhost.com
  • mx2.sub5.homie.mail.dreamhost.com
  • mx1.sub5.homie.mail.dreamhost.com

Target

  • hostmaster.dreamhost.com

HTTP Header Response

HTTP/1.1 200 OK Date: Sat, 10 Sep 2016 16:22:25 GMT Server: Apache Last-Modified: Wed, 10 Aug 2016 21:31:58 GMT ETag: "2eb-539be610eecc6" Accept-Ranges: bytes Content-Length: 747 Vary: Accept-Encoding Content-Type: text/html X-Cache: MISS from s_ub9 X-Cache-Lookup: MISS from s_ub9:80 Via: 1.1 s_ub9 (squid/3.5.20) Connection: keep-alive

DNS

host: cherrybeard.com
  1. class: IN
  2. ttl: 14400
  3. type: A
  4. ip: 67.205.11.203
host: cherrybeard.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: ns3.dreamhost.com
host: cherrybeard.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: ns1.dreamhost.com
host: cherrybeard.com
  1. class: IN
  2. ttl: 14400
  3. type: NS
  4. target: ns2.dreamhost.com
host: cherrybeard.com
  1. class: IN
  2. ttl: 14400
  3. type: SOA
  4. mname: ns1.dreamhost.com
  5. rname: hostmaster.dreamhost.com
  6. serial: 2016081001
  7. refresh: 17117
  8. retry: 1800
  9. expire: 1814400
  10. minimum-ttl: 14400
host: cherrybeard.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: mx2.sub5.homie.mail.dreamhost.com
host: cherrybeard.com
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: mx1.sub5.homie.mail.dreamhost.com

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.herrybeard.com, www.cdherrybeard.com, www.dherrybeard.com, www.crherrybeard.com, www.rherrybeard.com, www.ctherrybeard.com, www.therrybeard.com, www.cvherrybeard.com, www.vherrybeard.com, www.cfherrybeard.com, www.fherrybeard.com, www.cgherrybeard.com, www.gherrybeard.com, www.chherrybeard.com, www.hherrybeard.com, www.cnherrybeard.com, www.nherrybeard.com, www.cmherrybeard.com, www.mherrybeard.com, www.cjherrybeard.com, www.jherrybeard.com, www.cerrybeard.com, www.cheerrybeard.com, www.ceerrybeard.com, www.chderrybeard.com, www.cderrybeard.com, www.chcerrybeard.com, www.ccerrybeard.com, www.chuerrybeard.com, www.cuerrybeard.com, www.chjerrybeard.com, www.cjerrybeard.com, www.cherrybeard.com, www.cerrybeard.com, www.chberrybeard.com, www.cberrybeard.com, www.chgerrybeard.com, www.cgerrybeard.com, www.chrrybeard.com, www.chexrrybeard.com, www.chxrrybeard.com, www.chesrrybeard.com, www.chsrrybeard.com, www.chewrrybeard.com, www.chwrrybeard.com, www.cherrrybeard.com, www.chrrrybeard.com, www.chefrrybeard.com, www.chfrrybeard.com, www.chevrrybeard.com, www.chvrrybeard.com, www.checrrybeard.com, www.chcrrybeard.com, www.cheqrrybeard.com, www.chqrrybeard.com, www.chearrybeard.com, www.charrybeard.com, www.cheyrrybeard.com, www.chyrrybeard.com, www.cherybeard.com, www.cherirybeard.com, www.cheirybeard.com, www.cherorybeard.com, www.cheorybeard.com, www.cherlrybeard.com, www.chelrybeard.com, www.cherlrybeard.com, www.chelrybeard.com, www.cher.rybeard.com, www.che.rybeard.com, www.cherybeard.com, www.cherriybeard.com, www.cheriybeard.com, www.cherroybeard.com, www.cheroybeard.com, www.cherrlybeard.com, www.cherlybeard.com, www.cherrlybeard.com, www.cherlybeard.com, www.cherr.ybeard.com, www.cher.ybeard.com, www.cherrbeard.com, www.cherryzbeard.com, www.cherrzbeard.com, www.cherryabeard.com, www.cherrabeard.com, www.cherrysbeard.com, www.cherrsbeard.com, www.cherrydbeard.com, www.cherrdbeard.com, www.cherrybeard.com, www.cherrbeard.com, www.cherrycbeard.com, www.cherrcbeard.com, www.cherry beard.com, www.cherr beard.com, www.cherryeard.com, www.cherrybqeard.com, www.cherryqeard.com, www.cherrybweard.com, www.cherryweard.com, www.cherrybzeard.com, www.cherryzeard.com, www.cherrybxeard.com, www.cherryxeard.com, www.cherrybeard.com, www.cherryeard.com, www.cherrybseard.com, www.cherryseard.com, www.cherrybyeard.com, www.cherryyeard.com, www.cherrybeeard.com, www.cherryeeard.com, www.cherrybdeard.com, www.cherrydeard.com, www.cherrybceard.com, www.cherryceard.com, www.cherrybard.com, www.cherrybexard.com, www.cherrybxard.com, www.cherrybesard.com, www.cherrybsard.com, www.cherrybeward.com, www.cherrybward.com, www.cherryberard.com, www.cherrybrard.com, www.cherrybefard.com, www.cherrybfard.com, www.cherrybevard.com, www.cherrybvard.com, www.cherrybecard.com, www.cherrybcard.com, www.cherrybeqard.com, www.cherrybqard.com, www.cherrybeaard.com, www.cherrybaard.com, www.cherrybeyard.com, www.cherrybyard.com, www.cherryberd.com, www.cherrybeaord.com, www.cherrybeord.com, www.cherrybeaprd.com, www.cherrybeprd.com, www.cherrybea9rd.com, www.cherrybe9rd.com, www.cherrybeard.com, www.cherryberd.com, www.cherrybeaird.com, www.cherrybeird.com, www.cherrybeaurd.com, www.cherrybeurd.com, www.cherrybead.com, www.cherrybearid.com, www.cherrybeaid.com, www.cherrybearod.com, www.cherrybeaod.com, www.cherrybearld.com, www.cherrybeald.com, www.cherrybearld.com, www.cherrybeald.com, www.cherrybear.d.com, www.cherrybea.d.com,

Other websites we recently analyzed

  1. Berufsverband Tiergestützte Therapie, Pädagogik u. Fördermaßnahmen
    Homepage des Berufverbandes tiergestuetzte Paedagogik, Therapie und Foerdermaßnahmen. Informationen zum Thema tiergestuetzte Arbeit aus Forschung und Praxis.
    Germany - 217.160.233.198
    Server software: Apache
    Technology: CSS, Html
    Number of meta tags: 4
  2. gtib.cn.com
    China - 103.232.215.150
    Server software: Tengine/1.4.2
    Technology: Google Adsense, Html, Javascript, Php
    Number of Javascript: 2
    Number of meta tags: 1
  3. medicalmalpracticelawyerpennsylvania.com
    Houston (United States) - 108.167.131.22
    Server software: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1e-fips DAV/2 mod_bwlimited/1.4
    Technology: Html
    Number of meta tags: 1
  4. EQ Logik - Sönke Wulff
    Germany - 213.203.239.230
    Server software: Apache/2.0.55 (Debian) FrontPage/5.0.2.2635 PHP/4.4.2-1+b1 mod_ssl/2.0.55 OpenSSL/0.9.8c
    Technology: Html
    Number of meta tags: 1
  5. Fasching-Karneval-Shop
    Spezialist für Karneval, Fasching, Halloween Oktoberfest Weihnachten, Nikolaus, Ostern, 60er Jahre, 70er Jahre, 80er Jahre, Mottopartys, Themenpartys, Karnevalskostüme, Faschingskostüme, Perücken, Brillen, Bärte, Jungesellenabschied und Zubehör
    Germany - 62.104.45.105
    Server software: Apache
    Technology: CSS, Html, Javascript, jQuery UI
    Number of Javascript: 11
    Number of meta tags: 5
  6. Hoststar - Webspace und Hosting mit vielen Vorteilen - Top Webhosting zum sensationellen Preis
    Wir bieten Ihnen Webhosting, Reseller-Hosting, Domains und vServer für Ihren Internetauftritt bereits ab CHF 5.90 pro Monat.
    Germany - 5.9.101.76
    Server software: Apache
    Technology: CSS, Html, Html5, SVG
    Number of meta tags: 3
  7. Harry Sturm & Associates Inc
    Check out this GoDaddy hosted webpage! http://hsa-recruiting.com.
    Scottsdale (United States) - 97.74.42.79
    Server software: Microsoft-IIS/7.0
    Technology: CSS, Html, Javascript, jQuery, jQuery UI
    Number of Javascript: 4
    Number of meta tags: 3
  8. AAU Golf > Home
    United States - 12.179.190.211
    Server software: Redirector/1.0
    Technology: CSS, Html, Javascript, jQuery, jQuery Hover Intent, jQuery UI, comScore, Google Analytics, Google Publisher Tag, DotNetNuke
    Number of Javascript: 12
    Number of meta tags: 7
  9. jelenka.eu - Na úvod
    Czech Republic - 89.185.253.48
    Server software: Apache
    Technology: CSS, Html, Html5, Javascript, jQuery, jQuery Cycle, Php, Swf Object
    Number of Javascript: 11
    Number of meta tags: 3
  10. Hi-Tact – Singapore's Scaffolding Solutions
    Singapore - 103.11.189.21
    Server software: Apache
    Technology: CloudFlare, CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Revslider, SVG, Wordpress
    Number of Javascript: 12
    Number of meta tags: 3

Check Other Websites